Structure of PDB 3ab9 Chain A |
>3ab9A (length=127) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATV SAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWI FKIKASDESELESLLDATAYEALLEDE |
|
PDB | 3ab9 Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D43 L44 |
D42 L43 |
|
|
|
|