Structure of PDB 3ab3 Chain A

Receptor sequence

>3ab3A (length=322) Species: 10090 (Mus musculus)

RLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGM
RVLVDAREKLHIPWGDNKNQLHGDKLMAFDTRAPMAAQGMVETRVFLQYL
PAIRALWEDSGIQNAYDRRREFQLGESVKYFLDNLDKLGVPDYIPSQQDI
LLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFL
VSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLL
EEKVQVVSIKDYFLEFEGDPHCLRDVQKFLVECFRGKRRDPLYHHFTTAI
NTENIRLVFRDVKDTILHDNLK

3D structure

• PDB: 3ab3 Identification of critical residues in G(alpha)13 for stimulation of p115RhoGEF activity and the structure of the G(alpha)13-p115RhoGEF regulator of G protein signaling homology (RH) domain complex.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E58 T63 R200 D222 Q226
• Catalytic site (residue number reindexed from 1): E12 T17 R154 D176 Q180

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	S62 T203	S16 T157
BS02	GDP	A	E58 S59 G60 K61 S62 T63 S173 L197 L198 R200 N291 K292 D294 T348 A349 I350	E12 S13 G14 K15 S16 T17 S127 L151 L152 R154 N245 K246 D248 T298 A299 I300
BS03	ALF	A	G57 K61 R200 P202 T203 G224 G225 Q226	G11 K15 R154 P156 T157 G178 G179 Q180

Gene Ontology

Molecular Function

• GO:0001664 G protein-coupled receptor binding
• GO:0003924 GTPase activity
• GO:0019001 guanyl nucleotide binding
• GO:0031683 G-protein beta/gamma-subunit complex binding

Biological Process

• GO:0007165 signal transduction
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007266 Rho protein signal transduction

External links

• PDB: RCSB:3ab3, PDBe:3ab3, PDBj:3ab3
• PDBsum: 3ab3
• PubMed: 21507947
• UniProt: P27601|GNA13_MOUSE Guanine nucleotide-binding protein subunit alpha-13 (Gene Name=Gna13)