Structure of PDB 3a7k Chain A

Receptor sequence

>3a7kA (length=259) Species: 348780 (Natronomonas pharaonis DSM 2160)

VTQRELFEFVLNDPLLASSLYINIALAGLSILLFVFMTRGLDDPRAKLIA
VSTILVPVVSIASYTGLASGLTISVLEMPAGHFAEGSSVMLGGEEVDGVV
TMWGRYLTWALSTPMILLALGLLAGSNATKLFTAITFDIAMCVTGLAAAL
TTSSHLMRWFWYAISCACFIVVLYILLVEWAQDAKAAGTADIFSTLKLLT
VVMWLGYPIVWALGVEGVAVLPVGYTSWAYSALDIVAKYIFAFLLLNYLT
SNEGVVSGS

3D structure

• PDB: 3a7k Crystal Structure of the Light-Driven Chloride Pump Halorhodopsin from Natronomonas pharaonis.
• Chain: A
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RET	A	W127 T131 M159 Y180 S183 F187 W222 Y225 P226 W229 D252 K256	W109 T113 M141 Y162 S165 F169 W204 Y207 P208 W211 D234 K238
BS02	22B	A	A43 G46 I49 T56	A25 G28 I31 T38
BS03	CL	A	T126 S130 K256	T108 S112 K238
BS04	22B	A	T151 F155 I193	T133 F137 I175

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 12:44:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3a7k', asym_id = 'A', title = 'Crystal Structure of the Light-Driven Chloride Pump Halorhodopsin from Natronomonas pharaonis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3a7k', asym_id='A', title='Crystal Structure of the Light-Driven Chloride Pump Halorhodopsin from Natronomonas pharaonis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005216,0006811,0016020', uniprot = '', pdbid = '3a7k', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005216,0006811,0016020', uniprot='', pdbid='3a7k', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>