Structure of PDB 3a6n Chain A

Receptor sequence
>3a6nA (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSS
AVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB3a6n Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
ChainA
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y41 R42 P43 T45 R63 R72 F84 Q85 S86 R116 V117 T118 Y4 R5 P6 T8 R26 R35 F47 Q48 S49 R79 V80 T81
BS02 dna A R40 Y41 P43 G44 V46 R49 R63 L65 R69 R83 R3 Y4 P6 G7 V9 R12 R26 L28 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3a6n, PDBe:3a6n, PDBj:3a6n
PDBsum3a6n
PubMed20498094
UniProtQ16695|H31T_HUMAN Histone H3.1t (Gene Name=H3-4)

[Back to BioLiP]