Structure of PDB 2zzn Chain A

Receptor sequence

>2zznA (length=336) Species: 2190 (Methanocaldococcus jannaschii)

MPLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDIL
KSILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVV
GDLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELE
HLAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVV
DMFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILS
DVREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAI
KLFEKKCDCEVLEKRIVKSYAPREYILALDFKINKK

3D structure

• PDB: 2zzn Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation.
• Chain: A
• Resolution: 2.95 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K9 K10 G12 E13 R16 K27 I31 L38 K68 I71 K72 S75 R77 S94 L95 S96 Q107 R136 E139 V140 R145 R147 K163 N165 R168 Y177 R181 P267 K294 K318 S319 Y320 A321 P322 R323 E324	K9 K10 G12 E13 R16 K27 I31 L38 K68 I71 K72 S75 R77 S94 L95 S96 Q107 R136 E139 V140 R145 R147 K163 N165 R168 Y177 R181 P267 K294 K318 S319 Y320 A321 P322 R323 E324
BS02	rna	A	K191 V193 L195	K191 V193 L195
BS03	SAM	A	Y177 F178 R186 F203 P208 D223 I224 N225 D251 V252 N265 F273	Y177 F178 R186 F203 P208 D223 I224 N225 D251 V252 N265 F273

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity
• GO:0008175 tRNA methyltransferase activity
• GO:0016740 transferase activity
• GO:0052906 tRNA (guanine(37)-N1)-methyltransferase activity

Biological Process

• GO:0002939 tRNA N1-guanine methylation
• GO:0008033 tRNA processing
• GO:0030488 tRNA methylation
• GO:0032259 methylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2zzn, PDBe:2zzn, PDBj:2zzn
• PDBsum: 2zzn
• PubMed: 19749755
• UniProt: Q58293|TRM5B_METJA tRNA (guanine(37)-N1)-methyltransferase Trm5b (Gene Name=trm5b)