Structure of PDB 2zzm Chain A

Receptor sequence

>2zzmA (length=333) Species: 2190 (Methanocaldococcus jannaschii)

PLCLKINKKHGEQTRRILIENNLLNKDYKITSEGNYLYLPIKDVDEDILK
SILNIEFELVDKELEEKKIIKKPSFREIISKKYRKEIDEGLISLSYDVVG
DLVILQISDEVDEKIRKEIGELAYKLIPCKGVFRRKSEVKGEFRVRELEH
LAGENRTLTIHKENGYRLWVDIAKVYFSPRLGGERARIMKKVSLNDVVVD
MFAGVGPFSIACKNAKKIYAIDINPHAIELLKKNIKLNKLEHKIIPILSD
VREVDVKGNRVIMNLPKFAHKFIDKALDIVEEGGVIHYYTIGKDFDKAIK
LFEKKCDCEVLEKRIVKSYAPREYILALDFKIN

3D structure

• PDB: 2zzm Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation
• Chain: A
• Resolution: 2.65 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K9 G12 E13 R16 N23 L25 K27 K30 L38 R77 R85 G91 L92 I93 S94 L95 S96 Y97 Q107 P129 R136 E139 V140 R145 R147 K163 E164 N165 G166 Y177 R181 P267 X318 S319 Y320 A321 P322	K8 G11 E12 R15 N22 L24 K26 K29 L37 R76 R84 G90 L91 I92 S93 L94 S95 Y96 Q106 P128 R135 E138 V139 R144 R146 K162 E163 N164 G165 Y176 R180 P266 X317 S318 Y319 A320 P321
BS02	SAM	A	E143 F144 Y177 F178 R186 F203 P208 F209 D223 I224 D251 V252 N265 L266	E142 F143 Y176 F177 R185 F202 P207 F208 D222 I223 D250 V251 N264 L265

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity
• GO:0008175 tRNA methyltransferase activity
• GO:0016740 transferase activity
• GO:0052906 tRNA (guanine(37)-N1)-methyltransferase activity

Biological Process

• GO:0002939 tRNA N1-guanine methylation
• GO:0008033 tRNA processing
• GO:0030488 tRNA methylation
• GO:0032259 methylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2zzm, PDBe:2zzm, PDBj:2zzm
• PDBsum: 2zzm
• PubMed: 19749755
• UniProt: Q58293|TRM5B_METJA tRNA (guanine(37)-N1)-methyltransferase Trm5b (Gene Name=trm5b)