Structure of PDB 2zoc Chain A

Receptor sequence
>2zocA (length=319) Species: 9606 (Homo sapiens) [Search protein sequence]
MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQ
EIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMK
GAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQR
VLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSR
NRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYF
AEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIK
GDTSGDYRKVLLVLCGGDD
3D structure
PDB2zoc The comparison of the loop structure of membrane binding sites between human and bovine annexin IV
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A M99 G101 G103 D143 M99 G101 G103 D143
BS02 CA A G182 K185 G187 E227 G182 K185 G187 E227
BS03 CA A K225 T228 S229 E233 K225 T228 S229 E233
BS04 CA A M258 G260 G262 D302 M258 G260 G262 D302
Gene Ontology
Molecular Function
GO:0001786 phosphatidylserine binding
GO:0004859 phospholipase inhibitor activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005544 calcium-dependent phospholipid binding
GO:0042802 identical protein binding
GO:0048306 calcium-dependent protein binding
GO:0051059 NF-kappaB binding
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007165 signal transduction
GO:0007219 Notch signaling pathway
GO:0030855 epithelial cell differentiation
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0032717 negative regulation of interleukin-8 production
GO:0043066 negative regulation of apoptotic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0012506 vesicle membrane
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0031965 nuclear membrane
GO:0042589 zymogen granule membrane
GO:0048471 perinuclear region of cytoplasm
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zoc, PDBe:2zoc, PDBj:2zoc
PDBsum2zoc
PubMed
UniProtP09525|ANXA4_HUMAN Annexin A4 (Gene Name=ANXA4)

[Back to BioLiP]