Structure of PDB 2zne Chain A

Receptor sequence
>2zneA (length=168) Species: 9606 (Homo sapiens) [Search protein sequence]
DQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFD
RENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFG
YRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQD
GWIQVSYEQYLSMVFSIV
3D structure
PDB2zne Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
ChainA
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) F85 G108 I110
Catalytic site (residue number reindexed from 1) F62 G85 I87
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A F72 Y91 D94 W95 F122 G123 Y124 R125 Q159 T162 F165 R166 D169 Q172 F49 Y68 D71 W72 F99 G100 Y101 R102 Q136 T139 F142 R143 D146 Q149
BS02 ZN A D36 D38 V42 E47 D13 D15 V19 E24
BS03 ZN A D103 D105 S107 M109 E114 D80 D82 S84 M86 E91
BS04 ZN A D171 D173 D148 D150
BS05 ZN A D105 D111 D82 D88
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:2zne, PDBe:2zne, PDBj:2zne
PDBsum2zne
PubMed18940611
UniProtO75340|PDCD6_HUMAN Programmed cell death protein 6 (Gene Name=PDCD6)

[Back to BioLiP]