Structure of PDB 2zfo Chain A

Receptor sequence

>2zfoA (length=140) Species: 55676 (Oligobrachia mashikoi)

VCNRLEQILVKTQWAQSYGEAENRAAFSRDLFSELFNIQGSSRALFSGVG
VDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLD
ASNFAAMGQAVMSVVPTHLDCFNQHAWGECYERIASGISG

3D structure

• PDB: 2zfo Structure of the partially unliganded met state of 400 kDa hemoglobin: insights into ligand-induced structural changes of giant hemoglobins
• Chain: A
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	L45 F46 H62 A69 H94 R97 L99 N103 F104 I138	L45 F46 H62 A69 H94 R97 L99 N103 F104 I138
BS02	OXY	A	F32 F46 H62 V66	F32 F46 H62 V66
BS03	HEM	A	H89 Q93	H89 Q93

Gene Ontology

Molecular Function

• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001666 response to hypoxia
• GO:0015671 oxygen transport

Cellular Component

• GO:0005576 extracellular region
• GO:0005833 hemoglobin complex

External links

• PDB: RCSB:2zfo, PDBe:2zfo, PDBj:2zfo
• PDBsum: 2zfo
• PubMed: 18398907
• UniProt: Q7M419|GLBA1_OLIMA Extracellular giant hemoglobin major globin subunit A1 (Gene Name=ghbA1)