Structure of PDB 2zb8 Chain A

Receptor sequence

>2zb8A (length=342) Species: 9606 (Homo sapiens)

MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDP
YMRCRMNEDTITPWQLSQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQ
TKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGS
NKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDA
AINYKKDNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCG
QISQYNKDVPYPPPLSPAIEAIQKERNITRERFLVLNYKDKFEPGILQLS
QWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCIS

3D structure

• PDB: 2zb8 Structural basis for catalytic and inhibitory mechanisms of human prostaglandin reductase PTGR2.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.48: 15-oxoprostaglandin 13-reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	P50 M135 T139 G165 A166 C167 C187 G188 K192 Y208 N231 V232 C253 G254 I256 S257 Y259 V289 M332 M333 G335 N337	P50 M131 T135 G161 A162 C163 C183 G184 K188 Y204 N227 V228 C249 G250 I252 S253 Y255 V285 M328 M329 G331 N333
BS02	IMN	A	Y51 C54 Y100 L288	Y51 C54 Y96 L284

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
• GO:0047522 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity

Biological Process

• GO:0006629 lipid metabolic process
• GO:0006693 prostaglandin metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2zb8, PDBe:2zb8, PDBj:2zb8
• PDBsum: 2zb8
• PubMed: 19000823
• UniProt: Q8N8N7|PTGR2_HUMAN Prostaglandin reductase 2 (Gene Name=PTGR2)