Structure of PDB 2z6q Chain A

Receptor sequence

>2z6qA (length=327) Species: 735 (Haemophilus parahaemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKREAIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 2z6q The role of Arg165 towards base flipping, base stabilization and catalysis in M.HhaI
• Chain: A
• Resolution: 2.79 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	I86 N123 K234 G236 Q237 G256 G257 I258 S294 S296 Q297	I86 N123 K234 G236 Q237 G256 G257 I258 S294 S296 Q297
BS02	dna	A	I86 S87 K162 T226 R228 Q237 R240 Y242 I249 T250	I86 S87 K162 T226 R228 Q237 R240 Y242 I249 T250
BS03	dna	A	S87 G88 K89 R97 Q237 Y254 G255 G256	S87 G88 K89 R97 Q237 Y254 G255 G256
BS04	DCZ	A	C81 V121 R163 E164 T250 N304	C81 V121 R163 E164 T250 N304
BS05	SAH	A	F18 A19 G23 F24 E40 W41 D60 I61 G78 P80 N304 S305	F18 A19 G23 F24 E40 W41 D60 I61 G78 P80 N304 S305

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:2z6q, PDBe:2z6q, PDBj:2z6q
• PDBsum: 2z6q
• PubMed: 16926025
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)