Structure of PDB 2z6n Chain A

Receptor sequence
>2z6nA (length=141) Species: 167804 (Aldabrachelys gigantea) [Search protein sequence]
MLTEDDKQLIQHVWEKVLEHQEDFGAEALERMFIVYPSTKTYFPHFDLHH
DSEQIRHHGKKVVGALGDAVKHIDNLSATLSELSNLHAYNLRVDPVNFKL
LSHCFQVVLGAHLGREYTPQVQVAYDKFLAAVSAVLAEKYR
3D structure
PDB2z6n Crystal Structure of the Ligated Hemoglobin D from the Aldabra Giant Tortoise, Geochelone gigantea
ChainA
Resolution1.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A Y42 F43 H45 F46 H58 L83 H87 L91 V93 N97 F98 L101 L136 Y42 F43 H45 F46 H58 L83 H87 L91 V93 N97 F98 L101 L136
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2z6n, PDBe:2z6n, PDBj:2z6n
PDBsum2z6n
PubMed
UniProtP83134|HBAD_ALDGI Hemoglobin D subunit alpha

[Back to BioLiP]