Structure of PDB 2z6a Chain A

Receptor sequence

>2z6aA (length=327) Species: 735 (Haemophilus parahaemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPAQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 2z6a S-Adenosyl-l-methionine-Dependent Methyl Transfer: Observable Precatalytic Intermediates during DNA Cytosine Methylation
• Chain: A
• Resolution: 2.88 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	I86 K234 G236 Q237 G256 G257 S294	I86 K234 G236 Q237 G256 G257 S294
BS02	dna	A	F79 A81 Q82 S85 I86 S87 R97 E119 V121 K162 R165 T226 R228 Q237 R240 Y242 I249 T250 A253 Y254 G255 G256 N304	F79 A81 Q82 S85 I86 S87 R97 E119 V121 K162 R165 T226 R228 Q237 R240 Y242 I249 T250 A253 Y254 G255 G256 N304
BS03	SAH	A	F18 A19 G20 L21 E40 W41 D60 I61 G78 N304 S305 V306	F18 A19 G20 L21 E40 W41 D60 I61 G78 N304 S305 V306

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:2z6a, PDBe:2z6a, PDBj:2z6a
• PDBsum: 2z6a
• PubMed: 17616174
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)