Structure of PDB 2yx7 Chain A |
>2yx7A (length=150) Species: 111955 (Sulfurisphaera tokodaii) [Search protein sequence] |
MDEIDLRILKILQYNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGY YAYINPASLNLDYIVITSVKAKYGKNYHVELGNKLAQIPGVWGVYFVLGD NDFIVMARYKTREEFMEKFLERVMSIPEVERASTQVVVKIIKESPNIVIF |
|
PDB | 2yx7 Crystal structure of glutamine receptor protein from Sulfolobus tokodaii strain 7 in complex with its effector L-glutamine: implications of effector binding in molecular association and DNA binding |
Chain | A |
Resolution | 2.05 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GLN |
A |
P30 K31 S32 |
P30 K31 S32 |
|
|
|
|