Structure of PDB 2yu4 Chain A |
>2yu4A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSSGSSGFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAY CPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSESGPSSG |
|
PDB | 2yu4 Solution structure of the SP-RING domain in non-SMC element 2 homolog (MMS21, S. cerevisiae) |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C26 H28 C51 C56 |
C26 H28 C51 C56 |
|
|
|
|