Structure of PDB 2ylg Chain A

Receptor sequence

>2ylgA (length=126) Species: 85698 (Achromobacter xylosoxidans)

EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKT
LSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAG
DLDKLRAAFGDVGASCKACHDAYRKK

3D structure

• PDB: 2ylg Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
• Chain: A
• Resolution: 1.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	R12 Q13 A16 M19 A20 W56 F59 D67 Q83 F86 C116 C119 H120 R124	R12 Q13 A16 M19 A20 W56 F59 D67 Q83 F86 C116 C119 H120 R124
BS02	CMO	A	A16 M19	A16 M19	MOAD: Kd=28mM
BS03	ASC	A	F23 H120	F23 H120

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:2ylg, PDBe:2ylg, PDBj:2ylg
• PDBsum: 2ylg
• PubMed: 21900609
• UniProt: P00138|CYCP_ALCXX Cytochrome c'