Structure of PDB 2ylc Chain A

Receptor sequence

>2ylcA (length=66) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

QSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV
YKHAISTVVPSRPVSH

3D structure

• PDB: 2ylc Structural Basis for RNA 3' End Recognition by Hfq
• Chain: A
• Resolution: 1.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	U	A	F42 H57	F38 H53	PDBbind-CN: -logKd/Ki=7.89,Kd=13nM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:2ylc, PDBe:2ylc, PDBj:2ylc
• PDBsum: 2ylc
• PubMed: 21737752
• UniProt: P0A1R0|HFQ_SALTY RNA-binding protein Hfq (Gene Name=hfq)