Structure of PDB 2yk3 Chain A

Receptor sequence
>2yk3A (length=110) Species: 5656 (Crithidia fasciculata) [Search protein sequence]
ARAPLPPGDAARGEKLFKGRAAQCHTANQGGANGVGPNLYGLVGRHSGTI
EGYAYSKANAESGVVWTPDVLDVYLENPKKFMPGTKMSFAGMKKPQERAD
VIAYLETLKG
3D structure
PDB2yk3 Structure of a Trypanosomatid Mitochondrial Cytochrome C with Heme Attached Via Only One Thioether Bond and Implications for the Substrate Recognition Requirements of Heme Lyase.
ChainA
Resolution1.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A R24 A25 C28 H29 V39 G40 L46 S51 G52 I54 Y57 Y59 S60 N63 W70 Y78 L79 T89 K90 M91 S92 F93 R20 A21 C24 H25 V35 G36 L42 S47 G48 I50 Y53 Y55 S56 N59 W66 Y74 L75 T85 K86 M87 S88 F89
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2yk3, PDBe:2yk3, PDBj:2yk3
PDBsum2yk3
PubMed19459937
UniProtP00078|CYC_CRIFA Cytochrome c

[Back to BioLiP]