Structure of PDB 2y9h Chain A

Receptor sequence

>2y9hA (length=213) Species: 300852 (Thermus thermophilus HB8)

GAMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRL
EPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFR
LRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQI
LQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGP
GKALGLGLLSVAP

3D structure

• PDB: 2y9h An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	Y23 R43 K105 R106 L107 A108 K112 R113 R128 R129 R157 K159 K167 L169 Q170 R194 K200	Y25 R45 K107 R108 L109 A110 K114 R115 R130 R131 R159 K161 K169 L171 Q172 R196 K202
BS02	rna	A	K5 R52 F80 K83 G92 Q93 R94 P211	K7 R54 F82 K85 G94 Q95 R96 P213
BS03	rna	A	R13 R17 E24 R27 T28 K31	R15 R19 E26 R29 T30 K33

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity

Biological Process

• GO:0051607 defense response to virus

External links

• PDB: RCSB:2y9h, PDBe:2y9h, PDBj:2y9h
• PDBsum: 2y9h
• PubMed: 21572442
• UniProt: Q53WG9|CAS6_THET8 CRISPR-associated endoribonuclease Cse3 (Gene Name=cse3)