Structure of PDB 2y9g Chain A

Receptor sequence
>2y9gA (length=147) Species: 5630 (Laetiporus sulphureus) [Search protein sequence]
DIYIPPEGLYFRLLGFASRQVIFARNSPSPDVGLSPVNDQATDQYFSLIY
GTGEHAGLYAIKSKATGKVLFSRRPAEPYVGQIDGDGRYPDNWFKIEPGK
TYLSKYFRLVQPSTGTALVSRTHLQPYFWNHPQTEVFDDQYFTFLFE
3D structure
PDB2y9g High-Resolution Structural Insights on the Sugar-Recognition and Fusion Tag Properties of a Versatile Beta-Trefoil Lectin Domain from the Mushroom Laetiporus Sulphureus.
ChainA
Resolution1.67 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GAL A F73 R75 I85 Y91 D93 N94 F71 R73 I83 Y89 D91 N92
BS02 GAL A F73 R75 I85 Y91 D93 N94 F71 R73 I83 Y89 D91 N92
BS03 GLC A R123 L126 R121 L124
BS04 GAL A V121 R123 H125 H133 F139 D141 Q142 V119 R121 H123 H131 F137 D139 Q140
BS05 GAL A V121 R123 H125 H133 F139 D141 Q142 V119 R121 H123 H131 F137 D139 Q140
External links