Structure of PDB 2y69 Chain A

Receptor sequence

>2y69A (length=513) Species: 9913 (Bos taurus) [Search protein sequence]

FINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDD
QIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMS
FWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLH
LAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPV
LAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGF
GMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDT
RAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVG
GLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFS
GYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWN
TISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPP
YHTFEEPTYVNLK

3D structure

PDB

2y69 A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.

Chain

Resolution

1.95 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y19 V29 L33 I37 V58 H61 N80 D91 N98 S101 L105 W126 S156 S157 G160 T167 H240 E242 Y244 S255 G272 H290 H291 T316 K319 H376 F377 H378 R438 R439
Catalytic site (residue number reindexed from 1)	Y18 V28 L32 I36 V57 H60 N79 D90 N97 S100 L104 W125 S155 S156 G159 T166 H239 E241 Y243 S254 G271 H289 H290 T315 K318 H375 F376 H377 R437 R438
Enzyme Commision number	7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEA	A	A24 G27 T31 S34 I37 R38 Y54 V58 H61 A62 M65 M69 I73 G125 W126 Y371 F377 H378 S382 F393 M417 F425 R438 R439 V465 M468	A23 G26 T30 S33 I36 R37 Y53 V57 H60 A61 M64 M68 I72 G124 W125 Y370 F376 H377 S381 F392 M416 F424 R437 R438 V464 M467
BS02	HEA	A	W126 W236 V243 Y244 H290 H291 A313 G317 G352 L353 G355 I356 L358 A359 D364 H368 V373 H376 F377 V380 L381 R438	W125 W235 V242 Y243 H289 H290 A312 G316 G351 L352 G354 I355 L357 A358 D363 H367 V372 H375 F376 V379 L380 R437
BS03	CU	A	H240 H290 H291	H239 H289 H290
BS04	OXY	A	H240 H291	H239 H290
BS05	MG	A	H368 D369	H367 D368

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006119	oxidative phosphorylation
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0045277	respiratory chain complex IV

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2y69, PDBe:2y69, PDBj:2y69
PDBsum	2y69
PubMed	21211513
UniProt	P00396\|COX1_BOVIN Cytochrome c oxidase subunit 1 (Gene Name=MT-CO1)

[Back to BioLiP]