Structure of PDB 2y5p Chain A |
>2y5pA (length=72) Species: 1334565 (Listeria monocytogenes EGD) [Search protein sequence] |
MVYTVSYDVDGTVIKTKVEAGTRITAPKPPTKQGYVFKGWYTEKNGGHEW NFNTDYMSGNDFTLYAVFKAET |
|
PDB | 2y5p Fold and Function of the Inlb B-Repeat. |
Chain | A |
Resolution | 1.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E363 N365 |
E43 N45 |
|
|
|