Structure of PDB 2y4e Chain A

Receptor sequence

>2y4eA (length=384) Species: 83333 (Escherichia coli K-12)

SAPGTLSPDARNEKQPFYGEHQAGILTPQQAAMMLVAFDVLASDKADLER
LFRLLTQRFAFLTQGGAAPETPNPRLPPLDSGILGGYIAPDNLTITLSVG
HSLFDERFGLAPQMPKKLQKMTRFPNDSLDAALCHGDVLLQICANTQDTV
IHALRDIIKHTPDLLSVRWKREGFISDHAARSKGKETPINLLGFKDGTAN
PDSQNDKLMQKVVWVTADQQEPAWTIGGSYQAVRLIQFRVEFWDRTPLKE
QQTIFGRDKQTGAPLGMQHEHDVPDYASDPEGKVIALDSHIRLANPRTAE
SESSLMLRRGYSYSLGVTNSGQLDMGLLFVCYQHDLEKGFLTVQKRLNGE
ALEEYVKPIGGGYFFALPGVKDANDYFGSALLRV

3D structure

• PDB: 2y4e Efeb, the Peroxidase Component of the Efeuob Bacterial Fe(II) Transport System, Also Shows Novel Removal of Iron from Heme
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.-
  4.98.1.1: protoporphyrin ferrochelatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PP9	A	N194 K199 D200 G201 T202 A203 F259 R261 H294 I295 N299 M310 R312 F333 F344 V347 Q348 L351 L356 V360	N190 K195 D196 G197 T198 A199 F255 R257 H290 I291 N295 M306 R308 F329 F340 V343 Q344 L347 L352 V356

Gene Ontology

Molecular Function

• GO:0004325 ferrochelatase activity
• GO:0004601 peroxidase activity
• GO:0016829 lyase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006974 DNA damage response
• GO:0033212 iron import into cell
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005829 cytosol
• GO:0030288 outer membrane-bounded periplasmic space
• GO:0042597 periplasmic space

External links

• PDB: RCSB:2y4e, PDBe:2y4e, PDBj:2y4e
• PDBsum: 2y4e
• UniProt: P31545|EFEB_ECOLI Deferrochelatase (Gene Name=efeB)