Structure of PDB 2y1g Chain A

Receptor sequence

>2y1gA (length=374) Species: 83332 (Mycobacterium tuberculosis H37Rv)

GRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAHLDTLLRQRAQ
TGVTNIAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGL
RPTLAALKTGARLALANKESLVAGGSLVLRAARPGQIVPVDSEHSALAQC
LRGGTPDEVAKLVLTASGGPFRGWSAADLEHVTPEQAGSMGPMNTLNSAS
LVNKGLEVIETHLLFGIPYDRIDVVVHPQSIIHSMVTFIDGSTIAQASPP
DMKLPISLALGWPRRVSGAAAACDFHTASSWEFEPLDTDVFPAVELARQA
GVAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGIIADVLHAADQWAVEP
ATVDDVLDAQRWARERAQRAVSGM

3D structure

• PDB: 2y1g Design, Synthesis and X-Ray Crystallographic Studies of Alpha-Aryl Substituted Fosmidomycin Analogues as Inhibitors of Mycobacterium Tuberculosis 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase
• Chain: A
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FM5	A	D151 A176 S177 S213 N218 K219 S245 P265	D141 A166 S167 S198 N203 K204 S230 P250	MOAD: ic50=0.7uM PDBbind-CN: -logKd/Ki=6.15,IC50=0.7uM
BS02	MN	A	D151 E153 E222	D141 E143 E207

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 22:53:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '2y1g', asym_id = 'A', title = 'Design, Synthesis and X-Ray Crystallographic Stu... 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='2y1g', asym_id='A', title='Design, Synthesis and X-Ray Crystallographic Stu... 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0008299,0030604,0046872,0070402', uniprot = '', pdbid = '2y1g', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008299,0030604,0046872,0070402', uniprot='', pdbid='2y1g', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>