Structure of PDB 2xzw Chain A

Receptor sequence

>2xzwA (length=109) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805)

MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTEYTVEFL
QKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGE
KNADAISAW

3D structure

• PDB: 2xzw Mechanism of 2-Oxoglutarate Signaling by the Synechococcus Elongatus Pii Signal Transduction Protein.
• Chain: A
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	I7 G35 F36 G37 R38 Q39 I86 G87 G89 K90	I7 G35 F36 G37 R38 Q39 I80 G81 G83 K84
BS02	AKG	A	G37 Q39 K40 G41 L56 K58 G87	G37 Q39 K40 G41 L50 K52 G81	PDBbind-CN: -logKd/Ki=5.29,Kd=5.1uM
BS03	ATP	A	G27 M28 T29 V64 R101 R103	G27 M28 T29 V58 R95 R97

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0030234 enzyme regulator activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006808 regulation of nitrogen utilization

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2xzw, PDBe:2xzw, PDBj:2xzw
• PDBsum: 2xzw
• PubMed: 21041661
• UniProt: P0A3F4|GLNB_SYNE7 Nitrogen regulatory protein P-II (Gene Name=glnB)