Structure of PDB 2xtz Chain A

Receptor sequence
>2xtzA (length=343) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
MGSGIHIRKLLLLGAGESGKSTIFKQIKLLFQTGFDEGELKSYVPVIHAN
VYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDYPRL
TKDIAEGIETLWKDPAIQETCARGNELQVPDCTKYLMENLKRLSDINYIP
TKEDVLYARVRTTGVVEIQFSPVGEVYRLFDVGGQRNERRKWIHLFEGVT
AVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLN
KFDIFEKKVLDVPLNVCEWFRDYQPVSSGKQEIEHAYEFVKKKFEELYYQ
NTAPDRVDRVFKIYRTTALDQKLVKKTFKLVDETLRRRNLLEA
3D structure
PDB2xtz The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
ChainA
Resolution2.34 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E48 T53 R190 D218 Q222
Catalytic site (residue number reindexed from 1) E17 T22 R159 D181 Q185
Enzyme Commision number 3.6.5.1: heterotrimeric G-protein GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A S52 T193 S21 T162
BS02 GSP A G47 E48 S49 G50 K51 S52 T53 L187 Y188 R192 T193 G221 N287 K288 D290 I291 T354 A355 L356 G16 E17 S18 G19 K20 S21 T22 L156 Y157 R161 T162 G184 N250 K251 D253 I254 T317 A318 L319
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0005095 GTPase inhibitor activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016247 channel regulator activity
GO:0019001 guanyl nucleotide binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0046872 metal ion binding
GO:0051020 GTPase binding
Biological Process
GO:0003376 sphingosine-1-phosphate receptor signaling pathway
GO:0006571 tyrosine biosynthetic process
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0008219 cell death
GO:0009094 L-phenylalanine biosynthetic process
GO:0009738 abscisic acid-activated signaling pathway
GO:0009740 gibberellic acid mediated signaling pathway
GO:0009749 response to glucose
GO:0009785 blue light signaling pathway
GO:0009789 positive regulation of abscisic acid-activated signaling pathway
GO:0009845 seed germination
GO:0010027 thylakoid membrane organization
GO:0010119 regulation of stomatal movement
GO:0010244 response to low fluence blue light stimulus by blue low-fluence system
GO:0019236 response to pheromone
GO:0042127 regulation of cell population proliferation
GO:0072593 reactive oxygen species metabolic process
GO:0090333 regulation of stomatal closure
Cellular Component
GO:0005777 peroxisome
GO:0005789 endoplasmic reticulum membrane
GO:0005834 heterotrimeric G-protein complex
GO:0005886 plasma membrane
GO:0009506 plasmodesma

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xtz, PDBe:2xtz, PDBj:2xtz
PDBsum2xtz
PubMed21304159
UniProtP18064|GPA1_ARATH Guanine nucleotide-binding protein alpha-1 subunit (Gene Name=GPA1)

[Back to BioLiP]