Structure of PDB 2xti Chain A

Receptor sequence

>2xtiA (length=433) Species: 6279 (Brugia malayi)

TGVKIRDLVKHRNERVCIKGWIHRMRRQGKSLMFFILRDGTGFLQVLLMD
KLCQTYDALTVNTECTVEIYGAIKEVEAPNGHELIADFWKIIGNAPPGGI
DNVLNEEASVDKMLDNRHLVIRGENAAALLRLRAAATRAMREHFYNAGYV
EVAPPTLVQTQVEGGSTLFNLDYFGEQSFLTQSSQLYLETCIPTLGDVFC
IAQSYRAEKSRTRRHLAEYAHVEAECPFITLDDLMEKIEELVCDTVDRLL
ADEEAKKLLEHINPKFQPPERPFLRMEYKDAIKWLQEHNVENEFGNTFTY
GEDIAEAAERFMTDTINKPILLNRFPSEIKAFYMQRDAKDNTLTESVDLL
MPGVGEIVGGSMRIWKFDELSKAFKNVEIDPKPYYWYLDQRLYGTCPHGG
YGLGLERFICWLTNTNHIRDVCLYPRFVGRCVP

3D structure

• PDB: 2xti A Hybrid Structural Model of the Complete Brugia Malayi Cytoplasmic Asparaginyl-tRNA Synthetase.
• Chain: A
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NB8	A	E278 S298 Q300 R321 E323 H330 L331 Y334 H336 E338 Y448 E471 I472 V473 G474 R478 Y516 G517 G519 R522	E163 S183 Q185 R206 E208 H215 L216 Y219 H221 E223 Y333 E356 I357 V358 G359 R363 Y401 G402 G404 R407
BS02	POP	A	R329 H330 E471 R522	R214 H215 E356 R407

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 01:55:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '2xti', asym_id = 'A', title = 'A Hybrid Structural Model of the Complete Brugia Malayi Cytoplasmic Asparaginyl-tRNA Synthetase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='2xti', asym_id='A', title='A Hybrid Structural Model of the Complete Brugia Malayi Cytoplasmic Asparaginyl-tRNA Synthetase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000166,0003676,0004812,0004816,0005524,0006418,0006421', uniprot = '', pdbid = '2xti', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000166,0003676,0004812,0004816,0005524,0006418,0006421', uniprot='', pdbid='2xti', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>