Structure of PDB 2xqq Chain A

Receptor sequence
>2xqqA (length=87) Species: 9606 (Homo sapiens) [Search protein sequence]
DRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNP
TWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
3D structure
PDB2xqq Directed Evolution Reveals the Binding Motif Preference of the Lc8/Dynll Hub Protein and Predicts Large Numbers of Novel Binders in the Human Proteome
ChainA
Resolution1.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A K9 N61 F62 G63 S64 Y65 V66 T67 H68 F73 Y75 Y77 K7 N59 F60 G61 S62 Y63 V64 T65 H66 F71 Y73 Y75
BS02 peptide A E35 K36 E33 K34
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0045505 dynein intermediate chain binding
Biological Process
GO:0007017 microtubule-based process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0030286 dynein complex
GO:0031475 myosin V complex
GO:0097542 ciliary tip
GO:0097731 9+0 non-motile cilium
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xqq, PDBe:2xqq, PDBj:2xqq
PDBsum2xqq
PubMed21533121
UniProtQ96FJ2|DYL2_HUMAN Dynein light chain 2, cytoplasmic (Gene Name=DYNLL2)

[Back to BioLiP]