Structure of PDB 2xm3 Chain A

Receptor sequence
>2xm3A (length=126) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
EMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDILRDIAAQNGLEV
ITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFVAYPQLKEKLWG
GNLWNPSYCILTVSENTRAQIQKYIE
3D structure
PDB2xm3 DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K29 Y30 P81 V84 K85 K88 G89 A90 A92 R93 F96 G109 N110 W112 N113 P114 S115 Y116 K21 Y22 P73 V76 K77 K80 G81 A82 A84 R85 F88 G101 N102 W104 N105 P106 S107 Y108
BS02 dna A Y30 R31 H32 K105 L106 W107 Y22 R23 H24 K97 L98 W99
BS03 dna A K12 R14 Y16 V17 K4 R6 Y8 V9
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004803 transposase activity
GO:0046872 metal ion binding
Biological Process
GO:0006310 DNA recombination
GO:0006313 DNA transposition
GO:0032196 transposition

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xm3, PDBe:2xm3, PDBj:2xm3
PDBsum2xm3
PubMed20890269
UniProtQ7DF83|DRA2A_DEIRA ISDra2 transposase TnpA (Gene Name=tnpA)

[Back to BioLiP]