Structure of PDB 2xjz Chain A

Receptor sequence

>2xjzA (length=125) Species: 9606 (Homo sapiens) [Search protein sequence]

GCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCR
RDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCV
GDRYLLINSDIVCEQDIYEWTKING

3D structure

PDB

2xjz Structure of the Leukemia Oncogene Lmo2: Implications for the Assembly of a Hematopoietic Transcription Factor Complex.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	D32 R33 Y34 F35 L36 K37 I39 R62 R63 L64 Y65 Y66 K67 Y77 Q83 G85 I94 R95 A96 E98 M99 T100 M101 R102 K104 F122 C123 G125 D126 R127 Y128 L129	D8 R9 Y10 F11 L12 K13 I15 R38 R39 L40 Y41 Y42 K43 Y53 Q59 G61 I70 R71 A72 E74 M75 T76 M77 R78 K80 F98 C99 G101 D102 R103 Y104 L105
BS02	ZN	A	C115 C118 C137 D140	C91 C94 C113 D116
BS03	ZN	A	C87 C90 H109 C112	C63 C66 H85 C88
BS04	ZN	A	C50 C53 C73 D76	C26 C29 C49 D52
BS05	ZN	A	C26 H44 C47	C2 H20 C23

External links

PDB	RCSB:2xjz, PDBe:2xjz, PDBj:2xjz
PDBsum	2xjz
PubMed	21076045
UniProt	P25791\|RBTN2_HUMAN Rhombotin-2 (Gene Name=LMO2)