Structure of PDB 2xhh Chain A |
>2xhhA (length=119) Species: 155077 (Cellvibrio japonicus) [Search protein sequence] |
SNSITVRARGVNGQESVSLQVGGTTVQTWTLTTAMQDYTASTSLTGEIRV AFTNDATGRDVQVDYIVVNGQTRQAENQSVNTGVWANNQCGGSGNSEWLH CNGYISFGNVSLEHHHHHH |
|
PDB | 2xhh Circular Permutation Provides an Evolutionary Link between Two Families of Calcium-Dependent Carbohydrate Binding Modules |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
H118 H119 |
H118 H119 |
|
|
|