Structure of PDB 2xfv Chain A |
>2xfvA (length=108) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
ALEEVVRYLGPHNEIPLTLTRDSETGHFLLKHFLPILQQYHDTGNINETN PDSFPTDEERNKLLAHYGIAVNTDDRGELWIELEKCLQLLNMLNLFGLFQ DAFEFEEP |
|
PDB | 2xfv Structure of the Amino-Terminal Domain from the Cell-Cycle Regulator Swi6S |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
L31 K32 R61 |
L30 K31 R60 |
|
|
|