Structure of PDB 2xbq Chain A |
>2xbqA (length=105) Species: 6183 (Schistosoma mansoni) [Search protein sequence] |
SELIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDM IKKFI |
|
PDB | 2xbq Structural and Functional Characterization of Schistosoma Mansoni Thioredoxin. |
Chain | A |
Resolution | 1.67 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
C34 G35 P36 C37 |
Catalytic site (residue number reindexed from 1) |
C33 G34 P35 C36 |
Enzyme Commision number |
1.8.1.8: protein-disulfide reductase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E3 H20 |
E2 H19 |
|
|
|
|