Structure of PDB 2xbk Chain A

Receptor sequence

>2xbkA (length=391) Species: 68242 (Streptomyces natalensis)

DLPCLNLEPPKMLKLSPLLRALQDRGPIHRVRTPAGDEAWLVTRHAELKQ
LLHDERIGRTHPDPPSAAQYVRSPFLDLLISDADAESGRRQHAETRRLLT
PLFSARRVLEMQPKVEEAADTLLDAFIAQGPPGDLHGELTVPFALTVLCE
VIGVPPQRRAELTTLLAGIAKLDDREGAVRAQDDLFGYVAGLVEHKRAEP
GPDIISRLNDGELTEDRVAHLAMGLLFAGLDSVASIMDNGVVLLAAHPDQ
RAAALADPDVMARAVEEVLRTARAGGSVLPPRYASEDMEFGGVTIRAGDL
VLFDLGLPNFDERAFTGPEEFDAARTPNPHLTFGHGIWHCIGAPLARLEL
RTMFTKLFTRLPELRPELPVEQLRLKEGQLSGGFAELRVVW

3D structure

• PDB: 2xbk Structure of Cytochrome P450 Pimd Suggests Epoxidation of the Polyene Macrolide Pimaricin Occurs Via a Hydroperoxoferric Intermediate.
• Chain: A
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K177 A234 D237 S238 V239 G282 C346 I347 G348 E355 S387
• Catalytic site (residue number reindexed from 1): K171 A228 D231 S232 V233 G276 C340 I341 G342 E349 S381

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	R65 H98 R102 L231 A234 G235 S238 V239 R288 T338 F339 W344 C346 I347 G348 A352	R59 H92 R96 L225 A228 G229 S232 V233 R282 T332 F333 W338 C340 I341 G342 A346
BS02	XBK	A	F81 F233 S238 S241 R279 S283 S387	F75 F227 S232 S235 R273 S277 S381	MOAD: Kd=4uM

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:2xbk, PDBe:2xbk, PDBj:2xbk
• PDBsum: 2xbk
• PubMed: 20797613
• UniProt: Q9EW92