Structure of PDB 2x45 Chain A

Receptor sequence

>2x45A (length=144) Species: 34604 (Argas reflexus)

MDDCSGKTDAWTSIKGPKTGGYWLKQTTKTGENECTYVKGTDFKENTKTA
TYTYGYKDASGKLTKTTGTATAKGSDIVVGSDTSTVIYTDGKTCDVVKHG
GHTELWVHSSKTSGGYNNCCDKKFTETRGSTPANEVYKKCPGMP

3D structure

• PDB: 2x45 Crystal Structure of the Allergen Arg R 1, a Histamine-Binding Lipocalin from a Soft Tick
• Chain: A
• Resolution: 1.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HSM	A	S28 Y37 V53 Y67 D110 W121	S13 Y22 V38 Y52 D95 W106
BS02	HSM	A	Y69 D97 S99	Y54 D82 S84
BS03	HSM	A	H114 E119	H99 E104

Gene Ontology

Molecular Function

• GO:0043176 amine binding

Biological Process

• GO:0030682 symbiont-mediated perturbation of host defenses

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:2x45, PDBe:2x45, PDBj:2x45
• PDBsum: 2x45
• UniProt: Q5GQ85|ARGR1_ARGRF Allergen Arg r 1