Structure of PDB 2x1h Chain A

Receptor sequence

>2x1hA (length=340) Species: 9606 (Homo sapiens)

SMMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDIN
YSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFA
EYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTA
AAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVG
TVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTG
LSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVC
EVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELP

3D structure

• PDB: 2x1h Crystal Structure of the Human Mgc45594 Gene Product in Complex with Raloxifene
• Chain: A
• Resolution: 1.75 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.48: 15-oxoprostaglandin 13-reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	A67 T150 G174 G175 T176 S196 K200 Y215 S238 I260 G261 I263 S264 Y266 L296 M347 G350 N352	A46 T129 G153 G154 T155 S175 K179 Y194 S217 I239 G240 I242 S243 Y245 L275 M326 G329 N331
BS02	X1H	A	S68 N71 R76 Y77 F262 Y266 T270 L272 F295	S47 N50 R55 Y56 F241 Y245 T249 L251 F274
BS03	X1H	A	Y152 L155 K156 L183 K186 A187 M313	Y131 L134 K135 L162 K165 A166 M292

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003824 catalytic activity
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0047522 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity

Biological Process

• GO:0006629 lipid metabolic process
• GO:0008150 biological_process
• GO:0045599 negative regulation of fat cell differentiation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005777 peroxisome

External links

• PDB: RCSB:2x1h, PDBe:2x1h, PDBj:2x1h
• PDBsum: 2x1h
• UniProt: Q8N4Q0|PTGR3_HUMAN Prostaglandin reductase 3 (Gene Name=PTGR3)