Structure of PDB 2wy6 Chain A

Receptor sequence

>2wy6A (length=361) Species: 1502 (Clostridium perfringens)

WDGKIDGTGTHAMIVTQGVSILENDLSKNEPESVRKNLEILKENMHELQL
GSTYPDYDKNAYDLYQDHFWDPDIDNSWYLAYSIPDTGESQIRKFSALAR
YEWQRGNYKQATFYLGEAMHYFGDIDTPYHPANVTAVDSAGHVKFETFAE
ERKEQYKINTAGCKTNEAFYTDILKNKDFNAWSKEYARGFAKTGKSIYYS
HASMSHSWDDWDYAAKVTLANSQKGTAGYIYRFLHDVSEGNDPKNVKELV
AYISTSGEKDAGTDDYMYFGIKTKDGKTQEWEMDNPGNDFMTGSKDTYTF
KLKDENLKIDDIQNMWIRKRKYTAFPDAYKPENIKIIANGKVVVDKDINE
WISGNSTYNIK

3D structure

• PDB: 2wy6 Comparison of a Nontoxic Variant of Clostridium Perfringens [Alpha]-Toxin with the Toxic Wild-Type Strain
• Chain: A
• Resolution: 3.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H11 D56 H68 H126 D130 H136 H148 E152
• Catalytic site (residue number reindexed from 1): H11 D56 H68 H120 D124 H130 H142 E146
• Enzyme Commision number: 3.1.4.3: phospholipase C.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	W1 H11 D130	W1 H11 D124

Gene Ontology

Molecular Function

• GO:0004629 phospholipase C activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016788 hydrolase activity, acting on ester bonds
• GO:0034480 phosphatidylcholine phospholipase C activity
• GO:0046872 metal ion binding
• GO:0090729 toxin activity

Biological Process

• GO:0031640 killing of cells of another organism
• GO:0035821 modulation of process of another organism
• GO:0044179 hemolysis in another organism

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:2wy6, PDBe:2wy6, PDBj:2wy6
• PDBsum: 2wy6
• PubMed: 20944240
• UniProt: Q0TV31|PHLC_CLOP1 Phospholipase C (Gene Name=plc)