Structure of PDB 2wor Chain A

Receptor sequence
>2worA (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKG
TNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
3D structure
PDB2wor Identification and Characterization of Binding Sites on S100A7, a Participant in Cancer and Inflammation Pathways.
ChainA
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D62 N64 D66 K68 E73 D62 N64 D66 K68 E73
BS02 2AN A G11 M12 D14 M15 K18 G11 M12 D14 M15 K18 MOAD: Kd=125uM
PDBbind-CN: -logKd/Ki=3.90,Kd=125uM
BS03 ZN A H86 H90 H86 H90
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
GO:0140486 zinc ion sequestering activity
Biological Process
GO:0000302 response to reactive oxygen species
GO:0001525 angiogenesis
GO:0008544 epidermis development
GO:0010820 positive regulation of T cell chemotaxis
GO:0030216 keratinocyte differentiation
GO:0032496 response to lipopolysaccharide
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071624 positive regulation of granulocyte chemotaxis
GO:0090026 positive regulation of monocyte chemotaxis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0035578 azurophil granule lumen
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wor, PDBe:2wor, PDBj:2wor
PDBsum2wor
PubMed19810752
UniProtP31151|S10A7_HUMAN Protein S100-A7 (Gene Name=S100A7)

[Back to BioLiP]