Structure of PDB 2wku Chain A

Receptor sequence

>2wkuA (length=389) Species: 350 (Zoogloea ramigera)

SIVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVI
LGQVLPAGEGQNPARQAAMKAGVPQEATAWGMNQLCGSGLRAVALGMQQI
ATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMIKDGLTDAFY
GYHMGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFI
VKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVTAGNASGLNDGA
AAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERA
GWKIGDLDLVEAHEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGAS
GARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL

3D structure

• PDB: 2wku The Thiolase Reaction Mechanism: The Importance of Asn316 and His348 for Stabilizing the Enolate Intermediate of the Claisen Condensation.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C89 H348 C378 G380
• Catalytic site (residue number reindexed from 1): C86 H345 C375 G377
• Enzyme Commision number: 2.3.1.9: acetyl-CoA C-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DNO	A	S9 A10 R41 D197 F363	S6 A7 R38 D194 F360
BS02	DNO	A	K185 P334 S335 V337 V339	K182 P331 S332 V334 V336
BS03	DNO	A	V283 D284 T290	V280 D281 T287

Gene Ontology

Molecular Function

• GO:0003985 acetyl-CoA C-acetyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

Biological Process

• GO:0042619 poly-hydroxybutyrate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2wku, PDBe:2wku, PDBj:2wku
• PDBsum: 2wku
• PubMed: 19842716
• UniProt: P07097|THIL_SHIZO Acetyl-CoA acetyltransferase (Gene Name=phaA)