Structure of PDB 2wfg Chain A

Receptor sequence

>2wfgA (length=250) Species: 5476 (Candida albicans)

GYVGIKIRLTDVAPQAQELFKKESLDVKENKVYLVAATLRPETMYGQTCC
FVSPKIDYGVFDAGNGDYFITTERAFKNMSFQNLTPKRGYYKPLFTINGK
TLIGSRIDAPYAVNKNLRVLPMETVLATKGTGVVTCVPSDSPDDFVTTRD
LANKPEYYGIEKDWVQTDIVPIVHTEKYGDKCAEFLVNDLKIQSPKDSVQ
LANAKELAYKEGFYNGTMLIGKYKGDKVEDAKPKVKQDLIDEGLAFVYNE

3D structure

• PDB: 2wfg Crystal Structures of the Human and Fungal Cytosolic Leucyl-tRNA Synthetase Editing Domains: A Structural Basis for the Rational Design of Antifungal Benzoxaboroles.
• Chain: A
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZZB	A	A315 T316 L317 R318 T321 L404 K407 V412 D418 S419 K483 Y487	A37 T38 L39 R40 T43 L126 K129 V134 D140 S141 K205 Y209	MOAD: ic50=38uM PDBbind-CN: -logKd/Ki=4.42,IC50=38uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 04:32:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '2wfg', asym_id = 'A', title = 'Crystal Structures of the Human and Fungal Cytos...he Rational Design of Antifungal Benzoxaboroles. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='2wfg', asym_id='A', title='Crystal Structures of the Human and Fungal Cytos...he Rational Design of Antifungal Benzoxaboroles. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000166,0002161,0004823,0005524,0006418,0006429', uniprot = '', pdbid = '2wfg', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000166,0002161,0004823,0005524,0006418,0006429', uniprot='', pdbid='2wfg', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>