Structure of PDB 2wdo Chain A

Receptor sequence
>2wdoA (length=123) Species: 1902 (Streptomyces coelicolor) [Search protein sequence]
MSIIGVGIDVAEVERFGAALERTPALAGRLFLESELLLPGGERRGVASLA
ARFAAKEALAKALGAPAGLLWTDAEVWVEAGGRPRLRVTGTVAARAAELG
VASWHVSLSHDAGIASAVVIAEG
3D structure
PDB2wdo Analysis of Streptomyces Coelicolor Phosphopantetheinyl Transferase, Acps, Reveals the Basis for Relaxed Substrate Specificity.
ChainA
Resolution1.56 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K61 H110
Catalytic site (residue number reindexed from 1) K61 H110
Enzyme Commision number 2.7.8.7: holo-[acyl-carrier-protein] synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ACO A S48 R52 G82 R83 P84 L108 S109 H110 S48 R52 G82 R83 P84 L108 S109 H110 MOAD: Kd=2.4uM
BS02 COA A S48 R52 G81 G82 R83 P84 L108 S109 H110 S48 R52 G81 G82 R83 P84 L108 S109 H110
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0008897 holo-[acyl-carrier-protein] synthase activity
GO:0016740 transferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006633 fatty acid biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wdo, PDBe:2wdo, PDBj:2wdo
PDBsum2wdo
PubMed21595442
UniProtO86785|ACPS_STRCO Holo-[acyl-carrier-protein] synthase (Gene Name=acpS)

[Back to BioLiP]