Structure of PDB 2wcg Chain A

Receptor sequence

>2wcgA (length=493) Species: 9606 (Homo sapiens) [Search protein sequence]

ARPCIPKSFGYSSVVCVCNATYCDSFPALGTFSRYESTRSGRRMELSMGP
IQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLL
KSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTK
LKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIY
HQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPEH
QRDFIARDLGPTLANSTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKYV
HGIAVHWYLDFLAPAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLG
SWDRGMQYSHSIITNLLYHVVGWTDWNLALNPEGGPNWVRNFVDSPIIVD
ITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGS
AVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWHRQL

3D structure

PDB

2wcg 6-Amino-6-Deoxy-5,6-Di-N-(N'-Octyliminomethylidene)Nojirimycin: Synthesis, Biological Evaluation, and Crystal Structure in Complex with Acid Beta-Glucosidase.

Chain

Resolution

2.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	E235 E340 C342 N370
Catalytic site (residue number reindexed from 1)	E230 E335 C337 N365
Enzyme Commision number	2.4.1.- 3.2.1.- 3.2.1.45: glucosylceramidase. 3.2.1.46: galactosylceramidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MT5	A	D127 F128 N234 E235 Y313 E340 W381	D122 F123 N229 E230 Y308 E335 W376	MOAD: Ki=0.42uM PDBbind-CN: -logKd/Ki=6.38,Ki=0.42uM

Gene Ontology

	Molecular Function
GO:0004336	galactosylceramidase activity
GO:0004348	glucosylceramidase activity
GO:0005102	signaling receptor binding
GO:0005124	scavenger receptor binding
GO:0005515	protein binding
GO:0008422	beta-glucosidase activity
GO:0016757	glycosyltransferase activity
GO:0016787	hydrolase activity
GO:0016798	hydrolase activity, acting on glycosyl bonds
GO:0046527	glucosyltransferase activity
GO:0050295	steryl-beta-glucosidase activity

	Biological Process
GO:0006665	sphingolipid metabolic process
GO:0006678	glucosylceramide metabolic process
GO:0006680	glucosylceramide catabolic process
GO:0006914	autophagy
GO:0007005	mitochondrion organization
GO:0007040	lysosome organization
GO:0007417	central nervous system development
GO:0008203	cholesterol metabolic process
GO:0008340	determination of adult lifespan
GO:0009267	cellular response to starvation
GO:0009268	response to pH
GO:0014004	microglia differentiation
GO:0016241	regulation of macroautophagy
GO:0019882	antigen processing and presentation
GO:0019915	lipid storage
GO:0021694	cerebellar Purkinje cell layer formation
GO:0021859	pyramidal neuron differentiation
GO:0022904	respiratory electron transport chain
GO:0023021	termination of signal transduction
GO:0030259	lipid glycosylation
GO:0031175	neuron projection development
GO:0031333	negative regulation of protein-containing complex assembly
GO:0032006	regulation of TOR signaling
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032715	negative regulation of interleukin-6 production
GO:0033077	T cell differentiation in thymus
GO:0033574	response to testosterone
GO:0042391	regulation of membrane potential
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043243	positive regulation of protein-containing complex disassembly
GO:0043407	negative regulation of MAP kinase activity
GO:0043524	negative regulation of neuron apoptotic process
GO:0043627	response to estrogen
GO:0046512	sphingosine biosynthetic process
GO:0046513	ceramide biosynthetic process
GO:0048469	cell maturation
GO:0048854	brain morphogenesis
GO:0048872	homeostasis of number of cells
GO:0050728	negative regulation of inflammatory response
GO:0050877	nervous system process
GO:0050905	neuromuscular process
GO:0051246	regulation of protein metabolic process
GO:0051248	negative regulation of protein metabolic process
GO:0051402	neuron apoptotic process
GO:0061436	establishment of skin barrier
GO:0061518	microglial cell proliferation
GO:0061744	motor behavior
GO:0071356	cellular response to tumor necrosis factor
GO:0071425	hematopoietic stem cell proliferation
GO:0071548	response to dexamethasone
GO:0072676	lymphocyte migration
GO:0097066	response to thyroid hormone
GO:0098773	skin epidermis development
GO:1901805	beta-glucoside catabolic process
GO:1903052	positive regulation of proteolysis involved in protein catabolic process
GO:1903061	positive regulation of protein lipidation
GO:1904457	positive regulation of neuronal action potential
GO:1905037	autophagosome organization
GO:1905165	regulation of lysosomal protein catabolic process

	Cellular Component
GO:0005615	extracellular space
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005783	endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005802	trans-Golgi network
GO:0016020	membrane
GO:0043202	lysosomal lumen
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2wcg, PDBe:2wcg, PDBj:2wcg
PDBsum	2wcg
PubMed	19437524
UniProt	P04062\|GBA1_HUMAN Lysosomal acid glucosylceramidase (Gene Name=GBA1)

[Back to BioLiP]