Structure of PDB 2wc8 Chain A

Receptor sequence

>2wc8A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence]

STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKD
KAVIDEIFQGLDAQVDFQEFISLVAIALKAAHYHTHKE

3D structure

PDB

2wc8 The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.

Chain

Resolution

1.88 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H15 D25	H16 D26
BS02	ZN	A	H85 H89	H82 H86

Gene Ontology

	Molecular Function
GO:0005507	copper ion binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0048306	calcium-dependent protein binding
GO:0050786	RAGE receptor binding

	Biological Process
GO:0002548	monocyte chemotaxis
GO:0006805	xenobiotic metabolic process
GO:0006954	inflammatory response
GO:0030593	neutrophil chemotaxis
GO:0031640	killing of cells of another organism
GO:0042742	defense response to bacterium
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0043406	positive regulation of MAP kinase activity
GO:0043542	endothelial cell migration
GO:0045087	innate immune response
GO:0045576	mast cell activation
GO:0050729	positive regulation of inflammatory response
GO:0050832	defense response to fungus
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide

External links

PDB	RCSB:2wc8, PDBe:2wc8, PDBj:2wc8
PDBsum	2wc8
PubMed	19501594
UniProt	P80511\|S10AC_HUMAN Protein S100-A12 (Gene Name=S100A12)