Structure of PDB 2wa8 Chain A

Receptor sequence
>2wa8A (length=88) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQ
GKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEKA
3D structure
PDB2wa8 Structural Basis of N-End Rule Substrate Recognition in Escherichia Coli by the Clpap Adaptor Protein Clps.
ChainA
Resolution2.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A N34 D35 T38 P39 M40 V43 T59 Q60 L63 V65 H66 L99 N16 D17 T20 P21 M22 V25 T41 Q42 L45 V47 H48 L81
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0051087 protein-folding chaperone binding
GO:0140678 molecular function inhibitor activity
Biological Process
GO:0006508 proteolysis
GO:0009408 response to heat
GO:0030163 protein catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wa8, PDBe:2wa8, PDBj:2wa8
PDBsum2wa8
PubMed19373253
UniProtP0A8Q6|CLPS_ECOLI ATP-dependent Clp protease adapter protein ClpS (Gene Name=clpS)

[Back to BioLiP]