Structure of PDB 2w7n Chain A

Receptor sequence
>2w7nA (length=94) Species: 562 (Escherichia coli) [Search protein sequence]
KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAV
SQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKK
3D structure
PDB2w7n Crystal Structure of Kora Bound to Operator DNA: Insight Into Repressor Cooperation in Rp4 Gene Regulation
ChainA
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna A E18 V19 G20 Q22 T47 A50 Q53 R57 E17 V18 G19 Q21 T46 A49 Q52 R56 PDBbind-CN: Kd=23.3nM
BS02 dna A Q37 A38 R48 S52 Q53 Q36 A37 R47 S51 Q52 PDBbind-CN: Kd=23.3nM
BS03 dna A Q37 A38 R48 S52 Q53 Q36 A37 R47 S51 Q52 PDBbind-CN: Kd=23.3nM
BS04 dna A E18 G20 Q22 T23 L46 T47 A50 Q53 R57 E17 G19 Q21 T22 L45 T46 A49 Q52 R56 PDBbind-CN: Kd=23.3nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding

View graph for
Molecular Function
External links
PDB RCSB:2w7n, PDBe:2w7n, PDBj:2w7n
PDBsum2w7n
PubMed19190096
UniProtP03052|KORA2_ECOLX TrfB transcriptional repressor protein (Gene Name=trfB)

[Back to BioLiP]