Structure of PDB 2w4q Chain A

Receptor sequence

>2w4qA (length=349) Species: 9606 (Homo sapiens)

MMIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVD
PYMRCRMNEDTGTDYITPWQLSQVVDGGGIGIIEESKHTNLTKGDFVTSF
YWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGH
ITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSE
LGFDAAINYKKDNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSH
IILCGQISQYNKDVPYPPPLSPAIEAIQKERNITRERFLVLNYKDKFEPG
ILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEE

3D structure

• PDB: 2w4q Crystal Structure of Human Zinc-Binding Alcohol Dehydrogenase 1
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.48: 15-oxoprostaglandin 13-reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	P50 T139 G165 A166 C167 C187 G188 K192 Y208 N231 C253 I256 S257 V289 M332 G335 N337	P51 T140 G166 A167 C168 C188 G189 K193 Y209 N232 C254 I257 S258 V290 M333 G336 N338
BS02	CBW	A	Y51 Y64 Y100 Y259 Y265	Y52 Y65 Y101 Y260 Y266
BS03	CBW	A	V117 F129 E297	V118 F130 E298

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
• GO:0047522 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity

Biological Process

• GO:0006629 lipid metabolic process
• GO:0006693 prostaglandin metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2w4q, PDBe:2w4q, PDBj:2w4q
• PDBsum: 2w4q
• UniProt: Q8N8N7|PTGR2_HUMAN Prostaglandin reductase 2 (Gene Name=PTGR2)