Structure of PDB 2vz7 Chain A

Receptor sequence

>2vz7A (length=396) Species: 54571 (Streptomyces venezuelae)

PPVLDLGALGQDFAADPYPTYARLRAEGPAHRVRTPEGNEVWLVVGYDRA
RAVLADPRFSKDWRNSTTPLTEAEAALNHNMLESDPPRHTRLRKLVAREF
TMRRVELLRPRVQEIVDGLVDAMLAAPDGRADLMESLAWPLPITVISELL
GVPEPDRAAFRVWTDAFVFPDDPAQAQTAMAEMSGYLSRLIDSKRGQDGE
DLLSALVRTSDEDGSRLTSEELLGMAHILLVAGHETTVNLIANGMYALLS
HPDQLAALRADMTLLDGAVEEMLRYEGPVESATYRFPVEPVDLDGTVIPA
GDTVLVVLADAHRTPERFPDPHRFDIRRDTAGHLAFGHGIHFCIGAPLAR
LEARIAVRALLERCPDLALDVSPGELVWYPNPMIRGLKALPIRWRR

3D structure

• PDB: 2vz7 Analysis of Transient and Catalytic Desosamine Binding Pockets in Cytochrome P450 Pikc from Streptomyces Venezuelae.
• Chain: A
• Resolution: 3.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D23 P47 F180 A243 E246 T247 T248 V290 C354 I355 G356 E363 I395
• Catalytic site (residue number reindexed from 1): D12 P36 F169 A232 E235 T236 T237 V279 C343 I344 G345 E352 I384
• Enzyme Commision number: 1.14.15.33: pikromycin synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	M92 L93 H100 R104 A243 G244 T247 T248 L251 P289 A293 T294 R296 F347 H352 C354 I355	M81 L82 H89 R93 A232 G233 T236 T237 L240 P278 A282 T283 R285 F336 H341 C343 I344
BS02	PXI	A	W74 E85 E94 F178 V179 V242 A243 M394 I395	W63 E74 E83 F167 V168 V231 A232 M383 I384

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0017000 antibiotic biosynthetic process
• GO:0033068 macrolide biosynthetic process

External links

• PDB: RCSB:2vz7, PDBe:2vz7, PDBj:2vz7
• PDBsum: 2vz7
• PubMed: 19124459
• UniProt: O87605|PIKC_STRVZ Cytochrome P450 monooxygenase PikC (Gene Name=pikC)