Structure of PDB 2vwh Chain A

Receptor sequence

>2vwhA (length=357) Species: 2252 (Haloferax mediterranei)

MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHG
GFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFE
RDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIE
PISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYE
NLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEAT
GFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVG
SVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKT
AIEFSTV

3D structure

• PDB: 2vwh Active site dynamics in the zinc-dependent medium chain alcohol dehydrogenase superfamily.
• Chain: A
• Resolution: 2.03 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.47: glucose 1-dehydrogenase [NAD(P)(+)].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	G39 T40 N181 G182 L184 G206 R207 R208 S228 H255 L272 V302	G39 T40 N181 G182 L184 G206 R207 R208 S228 H255 L272 V302
BS02	BGC	A	T40 H63 E114 E150 V302 N303	T40 H63 E114 E150 V302 N303
BS03	ZN	A	D38 H63	D38 H63

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0005536 D-glucose binding
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding
• GO:0047934 glucose 1-dehydrogenase (NAD+) activity
• GO:0047935 glucose 1-dehydrogenase (NADP+) activity
• GO:0047936 glucose 1-dehydrogenase [NAD(P)+] activity
• GO:0070401 NADP+ binding
• GO:0070403 NAD+ binding

Biological Process

• GO:0019595 non-phosphorylated glucose catabolic process

External links

• PDB: RCSB:2vwh, PDBe:2vwh, PDBj:2vwh
• PDBsum: 2vwh
• PubMed: 19131516
• UniProt: Q977U7|GLCDH_HALMT Glucose 1-dehydrogenase (Gene Name=gdh)