Structure of PDB 2vry Chain A

Receptor sequence
>2vryA (length=147) Species: 10090 (Mus musculus) [Search protein sequence]
RPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSP
EDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVR
LSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWD
3D structure
PDB2vry An X-Ray Diffraction and X-Ray Absorption Spectroscopy Joint Study of Neuroglobin.
ChainA
Resolution1.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.7.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A F42 Y44 H64 K67 V68 V71 H96 V99 V101 V109 F40 Y42 H62 K65 V66 V69 H94 V97 V99 V107
Gene Ontology
Molecular Function
GO:0005092 GDP-dissociation inhibitor activity
GO:0005344 oxygen carrier activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:0098809 nitrite reductase activity
Biological Process
GO:0015671 oxygen transport
GO:0071456 cellular response to hypoxia
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2vry, PDBe:2vry, PDBj:2vry
PDBsum2vry
PubMed18406335
UniProtQ9ER97|NGB_MOUSE Neuroglobin (Gene Name=Ngb)

[Back to BioLiP]