Structure of PDB 2vnf Chain A

Receptor sequence
>2vnfA (length=50) Species: 9606 (Homo sapiens) [Search protein sequence]
EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQ
3D structure
PDB2vnf Molecular Basis of Histone H3K4Me3 Recognition by Ing4
ChainA
Resolution1.76 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y198 S205 Y206 G207 E208 M209 I210 G211 C212 D213 W221 K232 P233 G235 Y4 S11 Y12 G13 E14 M15 I16 G17 C18 D19 W27 K38 P39 G41
BS02 peptide A Q203 Y206 Q9 Y12
BS03 ZN A C199 C201 H223 C226 C5 C7 H29 C32
BS04 ZN A C212 C217 C239 C242 C18 C23 C45 C48
External links
PDB RCSB:2vnf, PDBe:2vnf, PDBj:2vnf
PDBsum2vnf
PubMed18381289
UniProtQ9UNL4|ING4_HUMAN Inhibitor of growth protein 4 (Gene Name=ING4)

[Back to BioLiP]